A practical reference on Aggregation: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2025-08-18. Anything still debated is marked as such rather than presented as settled.
Handling practice centers on limiting moisture, heat, and mechanical stress. Powder is typically allowed to reach room temperature before opening so that condensation does not form on the contents, and solutions are prepared with sterile or low-particulate water. Peptides can adsorb to certain plastics and membrane filters, so container and filter material is sometimes specified to reduce losses at low concentrations. Working aliquots are usually frozen separately rather than sampled repeatedly from one stock. Recording lot number, preparation date, and storage conditions supports later comparison between experiments.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography, which separates the target peptide from truncated sequences and other synthesis by-products. Mass spectrometry, typically electrospray ionization coupled to liquid chromatography, confirms the expected mass and helps detect modifications. Amino acid analysis can verify composition when residue-level confirmation is needed. Because common impurities differ from the target by only one or two residues, chromatographic resolution often matters more than a single headline purity percentage. Impurity profiles are most informative when compared against a validated reference standard.
Lyophilized material is generally reported as stable for extended periods when kept cold, dry, and protected from light. In solution, the main degradation routes for a peptide of this type are hydrolysis of peptide bonds and aggregation. The sequence contains no cysteine, so disulfide-driven oxidation is not a primary concern, though methionine and tryptophan are also absent. Stability depends on pH, buffer composition, and concentration, with acidic conditions often reported as more favorable than neutral or alkaline ones. Repeated freeze-thaw cycles can promote aggregation, and how fast degradation proceeds at room temperature in specific formulations remains an open question.
The main chemical liabilities of this sequence are peptide-bond hydrolysis and possible aspartate-related reactions, since the peptide contains aspartic acid residues but no cysteine, methionine, or tryptophan. Absence of those three residues removes the most common oxidation and disulfide pathways from consideration. Studies of related peptides indicate that aspartate isomerisation and aspartimide formation occur most readily at Asp-Gly and Asp-Ala positions, and open questions remain about how quickly those reactions proceed under ordinary laboratory conditions. Storage guidance typically emphasises cool, dry, dark conditions to slow hydrolysis.
Identity and purity are usually assessed with reversed-phase high-performance liquid chromatography, often paired with mass spectrometry using electrospray or MALDI ionisation. Amino acid analysis and peptide mapping by enzymatic digestion provide additional sequence-level confirmation. Purity is commonly reported as an area percentage from a chromatographic trace, and water content can be measured by Karl Fischer titration. Reported masses may differ by tens of daltons between sources because preparations can contain acetate or trifluoroacetate counterions, and such differences are not by themselves evidence of a different peptide.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Typical lyophilized form |
| Solubility | Freely soluble in water | Also dissolves in common polar solvents |
| Storage temperature | Minus 20 degrees Celsius or lower | Applies to dry powder, desiccated and dark |
| Typical analytical methods | Reversed-phase HPLC and mass spectrometry | Used together for purity and identity |
| Primary degradation route | Hydrolysis and aggregation | No cysteine present, so disulfide formation is unlikely |
BPC-157 is a synthetic peptide of fifteen amino acids, written in single-letter code as GEPPPGKPADDAGLV. The sequence corresponds to a partial fragment of a protein isolated from human gastric juice, described in early reports as body protection compound. The number 157 refers to a fragment designation in that work rather than to molecular mass. Initial descriptions appeared in the early 1990s, when the fragment was reported to protect gastrointestinal tissue in animal models. Commercial material is produced by solid-phase peptide synthesis rather than extracted from biological sources.
Laboratory research on this peptide has examined a wide and heterogeneous set of endpoints, including gastric ulcer models, tendon and ligament injury, wound closure, and intestinal inflammation. Most published findings come from rodent studies, and reported effect sizes are often large relative to controls. Because the compound has been tested across many unrelated injury models, the literature is frequently described as unusually broad for a single peptide. A substantial share of this work originates from a small number of research groups, which matters when assessing how widely results have been reproduced.
BPC-157 is a synthetic peptide composed of fifteen amino acid residues, with the sequence Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val. Its name derives from body protection compound, a term used for a protein fraction identified in human gastric juice. Researchers in Zagreb first reported the pentadecapeptide in the early 1990s and described it as a stable fragment of that larger protein. The compound is also catalogued as PL 14736 and, in some commercial contexts, as bepecin. Its molecular formula is C62H98N16O22 and its monoisotopic mass is approximately 1419 daltons.
Most published work on BPC-157 consists of preclinical studies, including rodent models of tissue injury, gastrointestinal lesions, and vascular or tendon damage, together with in vitro cell assays. Reviews frequently note that the mechanisms proposed in these papers remain incompletely characterised and that findings have not been confirmed in large randomised human trials. The compound is widely sold as a research chemical rather than a licensed medicine, and labels commonly carry a statement that it is not for human use. Whether any of the reported animal effects translate to humans is an open question rather than an established result.
Terminology in the literature is not fully standardised. Papers and product listings use BPC-157, BPC 157, and the longer phrase stable gastric pentadecapeptide BPC 157 interchangeably, and synonyms such as bepecin or PL 14736 appear in older or company-linked publications. Purity claims and reported masses can also differ between sources because peptide preparations may include counterions, residual solvents, or bound water. This variability complicates direct comparison of results across studies and makes the exact identity and grade of a given sample worth verifying. Discussions of the compound should therefore specify the source, salt form, and stated purity where those are known.
== Increasing stability of peptide drugs == Many strategies have been employed to increase the stability of peptide drugs, because although they have so many desirable characteristics, they are short lived in the body as a result of rapid degradation and clearance. With half-lives of some peptides and proteins only being a few minutes, they are very ineffective in drug delivery. Mechanisms involved in their clearance include peripheral blood mediated elimination by proteolysis, renal and hepatic elimination, and also receptor-mediated endocytosis. One of the main reasons for such rapid clearance is molecular weight. Molecules that have a low molecular weight (40-50 kDa) are rapidly cleared by renal filtration via the glomerular filtration barrier (GBM) into the urine. As a result of this, increasing the size of a peptide drug is a good starting point to improve half-life. Peptide modifications to extend half-life include PEGylation, glycosylation, cyclization, serum albumin binding, and lipidation. PEGylation is the attachment of polyethylene glycol (PEG) chains to the peptide via covalent bonds, helping to increase molecular weight, and limit enzymatic degradation as a result of steric hindrance caused by adding the PEG. PEGylation offers a number of benefits for pharmaceutical applications such as improved water solubility, high mobility in solution, as well as low toxicity and low immunogenicity. This does however depend on the molecular weight of the attached PEG.
This role was later taken up by the International Narcotics Control Board of the United Nations under Article 23 of the Single Convention on Narcotic Drugs, and subsequently under the Convention on Psychotropic Substances. Opium-producing nations are required to designate a government agency to take physical possession of licit opium crops as soon as possible after harvest and conduct all wholesaling and exporting through that agency.
== Side effects == The most common side effects are flu-like symptoms and include fever, rash, dermatographism, hyperpigmentation, alopecia (hair loss), chills, and Raynaud's phenomenon (discoloration of fingers and toes). The most serious complication of bleomycin, occurring upon increasing dosage, is pulmonary fibrosis and impaired lung function. It has been suggested that bleomycin induces sensitivity to oxygen toxicity and recent studies support the role of the proinflammatory cytokines IL-18 and IL-1beta in the mechanism of bleomycin-induced lung injury. Any previous treatment with bleomycin should therefore always be disclosed to the anaesthetist prior to undergoing a procedure requiring general anaesthesia. Due to the oxygen sensitive nature of bleomycin, and the theorised increased likelihood of developing pulmonary fibrosis following supplemental oxygen therapy, it has been questioned whether patients should take part in scuba diving following treatment with the drug. Bleomycin has also been found to disrupt the sense of taste.
== Pharmacology == The fenethylline molecule results when theophylline is covalently linked with amphetamine by an alkyl chain. Fenethylline is metabolized by the body to form two drugs, amphetamine (24.5% of oral dose) and theophylline (13.7% of oral dose), both of which are active stimulants. The physiological effects of fenethylline therefore seem to result from a combination of these two compounds, although it is not entirely clear how, and seems to involve a synergistic effect between amphetamine and theophylline produced following metabolism. The pharmacological actions of fenethylline before cleavage also remain poorly established, though it appears to act directly at several serotonin receptors.
Sources: en.wikipedia.org
Clicked peptide polymers are poly-triazole-poly-peptide hybrid polymers. They are made of repeating units of a 1,2,3-triazole and an oligopeptide. They can be visualized as an oligopeptide that is flanked at both the C-terminus and N-terminus by a triazole molecule.
=== Antidepressants === Medications that are indicated for both anxiety disorders and depression. Selective serotonin reuptake inhibitors (SSRIs) and serotonin–norepinephrine reuptake inhibitors (SNRIs) are new generations of antidepressants. They have a much lower adverse effect profile than older antidepressants like monoamine oxidase inhibitors (MAOIs) and tricyclic antidepressants (TCAs). Therefore, SSRIs and SNRIs are now the first-line agent in treating long term anxiety disorders, given their applications and significance in all six types of disorders.
== Chemistry == Bulevirtide is a 47-amino acid long lipopeptide with the following sequence: CH3(CH2)12CO-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2 (C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2)
Sources: en.wikipedia.org
"Cheese" is a heroin-based recreational drug that came to the attention of the media inside and outside the United States after a string of deaths among adolescents in Dallas, between 2005 and 2007. As of 2012 the drug use was now among older people who were teenagers around the period the drug was first discovered. Cheese is a combination of drugs, made by combining heroin with crushed tablets of certain over-the-counter cold medication, such as Tylenol PM. Such cold medications contain acetaminophen (paracetamol), the active ingredient in Tylenol, and the antihistamine diphenhydramine, the active ingredient in Benadryl. Cheese samples obtained in north Dallas contained between 2% and 8% heroin, in contrast to the 30% commonly found in black tar heroin. Users commonly take the powder by insufflation ("snorting") rather than by intravenous injection. This mixture is also known as "Tylenol With Smack", by analogy to the Tylenol With Codeine series. Due to the high concentrations of non-opiate substances relative to the diamorphine content of the drug, abuse and overdose of cheese are more dangerous than pure-form opiate overdoses. Emergency personnel must address the overdose effects of each component of the drug, since the contents and concentrations of each component vary widely among batches they must wait for either the completion of the toxicology report to begin treatment or wait for the effects of each drugs overdose to manifest. The acetaminophen content of the drug induces severe, irreversible damage to the liver when taken in high doses for long periods of time.
=== Pharmacodynamics === Methaqualone acts primarily as a sedative, reducing anxiety and inducing sleep. It binds to GABAA receptors, where it functions as a positive allosteric modulator at many receptor subtypes, enhancing the inhibitory effects of the neurotransmitter GABA. It shows negligible affinity for a wide array of other potential targets, including other receptors and neurotransmitter transporters. This action is similar to that of benzodiazepines like diazepam. Unlike most benzodiazepines, however, methaqualone may also act as a negative allosteric modulator at certain GABAA receptor subtypes, producing excitatory effects in neurons expressing those receptors. As such, methaqualone is considered a mixed GABAA receptor modulator. The binding site for methaqualone on the GABAA receptor complex is distinct from those of benzodiazepines, barbiturates, and neurosteroids, though it may partially overlap with the etomidate binding site.
In 2007 a 10-year-old male Dalmatian dog was described with acromegalic signs such as an enlarged tongue and head, widened interdental space, and thickening of skin; along with other signs of hypersomatotropism such as polyphagia, obesity, and stridor. Insulin levels were heightened and the dog had glucose intolerance; however, the dog was not diabetic as blood glucose levels were found to be normal after multiple tests. Levels of IGF-1 and growth hormone were heightened. CT imaging showed a pituitary mass which was later confirmed to be an acidophilic adenoma stained for growth hormone; however, mammary tumour-induced acromegaly is rare with few reported cases. Hypothyroidism can increase levels of growth hormone and IGF-1 in dogs. Some of the physical changes in dogs with hypothyroidism may be due to increased growth hormone concentration.
Sources: en.wikipedia.org
Reversed-phase liquid chromatography with ultraviolet detection gives a purity estimate, while mass spectrometry confirms molecular mass and flags modifications. Amino acid analysis can add compositional confirmation. Results are most meaningful when a validated reference standard is run alongside the sample.
Cold, dry, and dark conditions are standard, typically at or below minus twenty degrees Celsius for long-term holding. Vials are usually warmed to room temperature before opening to prevent condensation. Repeated warming and cooling of the same vial is generally avoided.
This depends on pH, buffer, and concentration, with acidic conditions often reported as more favorable. Hydrolysis accelerates at room temperature, so solutions are commonly prepared fresh or stored frozen in single-use aliquots. No single shelf life applies across formulations.
Lyophilised peptide powders are generally kept frozen or refrigerated, dry, and protected from light. Sealed vials limit moisture uptake and slow hydrolysis. Such guidance comes from general peptide chemistry rather than from stability studies specific to every product.